Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Crossover junction endodeoxyribonuclease RuvC (ruvC)

Product Specifications

Product Name Alternative

Holliday junction nuclease RuvCHolliday junction resolvase RuvC

Abbreviation

Recombinant E.coli ruvC protein

Gene Name

RuvC

UniProt

P0A814

Expression Region

2-173aa

Organism

Escherichia coli (strain K12)

Target Sequence

AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Molecular Weight

34.6 kDa

References & Citations

A dual function of the CRISPR-Cas system in bacterial antivirus immunity and DNA repair.Babu M., Beloglazova N., Flick R., Graham C., Skarina T., Nocek B., Gagarinova A., Pogoutse O., Brown G., Binkowski A., Phanse S., Joachimiak A., Koonin E.V., Savchenko A., Emili A., Greenblatt J., Edwards A.M., Yakunin A.F.Mol. Microbiol. 79:484-502 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST9L Recombinant Protein (Rat)
RP196595 100 µg

CST9L Recombinant Protein (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal Cathepsin S Antibody (1F9) [DyLight 405]
NBP2-42634V 100 µL

Mouse Monoclonal Cathepsin S Antibody (1F9) [DyLight 405]

Sign In for Pricing
View Details
THOC6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
46662066 1.0 µg DNA

THOC6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ISLR sgRNA CRISPR Lentivector (Human) (Target 1)
K1101702 1.0 µg DNA

ISLR sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Antibiotic WB
HY-N12913 1 Each

Antibiotic WB

Sign In for Pricing
View Details
Anti-NT ProBNP
MBS483047-01 0.1 mg

Anti-NT ProBNP

Sign In for Pricing
View Details