Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas sp. Carboxypeptidase G2 (cpg2)

Product Specifications

Product Name Alternative

Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN: Glucarpidase

Abbreviation

Recombinant Pseudomonas sp. cpg2 protein

Gene Name

Cpg2

UniProt

P06621

Expression Region

23-415aa

Organism

Pseudomonas sp. (strain RS-16)

Target Sequence

ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Molecular Weight

68.7 kDa

References & Citations

Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.Rowsell S., Pauptit R.A., Tucker A.D., Melton R.G., Blow D.M., Brick P.Structure 5:337-347 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (HCAM/1097), CF740 conjugate, 0.1mg/mL
BNC741097-500 1x 500 µL

CD44 Standard (HCAM/1097), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR10G2 (N-term) Rabbit Polyclonal Antibody
AP53005PU-N 400 µL

OR10G2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RTN4IP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]
TA502543BM 100 µL

RTN4IP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details
iFluor™ 488 Conjugated Cytokeratin 14 Recombinant Rabbit Monoclonal Antibody [SC65-06]
HA720135F 100 µL

iFluor™ 488 Conjugated Cytokeratin 14 Recombinant Rabbit Monoclonal Antibody [SC65-06]

Sign In for Pricing
View Details
CA5B Antibody
KC-7312-01 50 μL

CA5B Antibody

Sign In for Pricing
View Details
CA5B Antibody
KC-7312-02 100 µL

CA5B Antibody

Sign In for Pricing
View Details