Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas sp. Carboxypeptidase G2 (cpg2)

Product Specifications

Product Name Alternative

Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN: Glucarpidase

Abbreviation

Recombinant Pseudomonas sp. cpg2 protein

Gene Name

Cpg2

UniProt

P06621

Expression Region

23-415aa

Organism

Pseudomonas sp. (strain RS-16)

Target Sequence

ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.

Molecular Weight

68.7 kDa

References & Citations

Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.Rowsell S., Pauptit R.A., Tucker A.D., Melton R.G., Blow D.M., Brick P.Structure 5:337-347 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butyl Benzoate
TRC-B120000-5G 5 g

Butyl Benzoate

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2421), CF488A conjugate, 0.1mg/mL
BNC882421-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2421), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTUS1 (NM_001001931) Human Over-expression Lysate
LY424280 100 µg

MTUS1 (NM_001001931) Human Over-expression Lysate

Sign In for Pricing
View Details
VX 809
TRC-V900700-5MG 5 mg

VX 809

Sign In for Pricing
View Details
Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF488A conjugate, 0.1mg/mL
BNC882190-500 1x 500 µL

Frataxin (Marker of Friedreich Ataxia) (FXN/2124), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALDH3B1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF811463 100 µg

ALDH3B1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

Sign In for Pricing
View Details