Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA)

Product Specifications

Product Name Alternative

LptA; yhbN; b3200; JW3167; Lipopolysaccharide export system protein LptA

Abbreviation

Recombinant E.coli lptA protein

Gene Name

LptA

UniProt

P0ADV1

Expression Region

28-185aa

Organism

Escherichia coli (strain K12)

Target Sequence

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in the assbly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner mbrane to the outer mbrane. May form a bridge between the inner mbrane and the outer mbrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the assembly of lipopolysaccharide (LPS) . Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

Molecular Weight

33.3 kDa

References & Citations

Characterization of interactions between LPS transport proteins of the Lpt system.Bowyer A., Baardsnes J., Ajamian E., Zhang L., Cygler M.Biochem. Biophys. Res. Commun. 404:1093-1098 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT222 Antibody
MBS8593511-01 0.1 mg

KRT222 Antibody

Sign In for Pricing
View Details
KRT222 Antibody
MBS8593511-02 0.1 mL (AF405L)

KRT222 Antibody

Sign In for Pricing
View Details
KRT222 Antibody
MBS8593511-03 0.1 mL (AF405S)

KRT222 Antibody

Sign In for Pricing
View Details
KRT222 Antibody
MBS8593511-04 0.1 mL (AF610)

KRT222 Antibody

Sign In for Pricing
View Details
KRT222 Antibody
MBS8593511-05 0.1 mL (AF635)

KRT222 Antibody

Sign In for Pricing
View Details
KRT222 Antibody
MBS8593511-06 0.1 mL (APC)

KRT222 Antibody

Sign In for Pricing
View Details