Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Lipopolysaccharide assembly protein B (lapB), partial

Product Specifications

Product Name Alternative

LapB; yciM; b1280; JW1272; Lipopolysaccharide assembly protein B; Lipopolysaccharide regulatory protein

Abbreviation

Recombinant E.coli lapB protein, partial

Gene Name

LapB

UniProt

P0AB58

Expression Region

17-389aa

Organism

Escherichia coli (strain K12)

Target Sequence

WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Modulates cellular lipopolysaccharide (LPS) levels by regulating LpxC, which is involved in lipid A biosynthesis. May act by modulating the proteolytic activity of FtsH towards LpxC. May also coordinate assembly of proteins involved in LPS synthesis at the plasma membrane.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

58.8 kDa

References & Citations

"Complete genome sequences of Escherichia coli strains 1303 and ECC-1470 isolated from bovine mastitis."Leimbach A., Poehlein A., Daniel R., Dobrindt U.Submitted (DEC-2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-100 1x 100 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
BNC681037-100 1x 100 µL

CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details