Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Enterotoxin type G (entG)

Product Specifications

Product Name Alternative

SEG

Abbreviation

Recombinant Staphylococcus aureus entG protein

Gene Name

EntG

UniProt

P0A0L7

Expression Region

26-258aa

Organism

Staphylococcus aureus (strain N315)

Target Sequence

QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Molecular Weight

43 kDa

References & Citations

Whole genome sequencing of meticillin-resistant Staphylococcus aureus.Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y. , Takahashi N.K., Sawano T., Inoue R., Kaito C., Sekimizu K., Hirakawa H., Kuhara S., Goto S., Yabuzaki J., Kanehisa M., Yamashita A., Oshima K., Furuya K., Yoshino C., Shiba T., Hattori M., Ogasawara N., Hayashi H., Hiramatsu K.Lancet 357:1225-1240 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK2 Recombinant Antibody, Cy7 Conjugated
bsm-62026R-Cy7 100 µL

NEK2 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
ASB14
CSB-CL002183HU 10 μg Plasmid + 200 μL Glycerol

ASB14

Sign In for Pricing
View Details
CK18 Monoclonal Antibody, PE-Cy5 Conjugated
bsm-33102M-PE-Cy5 100 µL

CK18 Monoclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal pan Cytokeratin Antibody (AE1 + AE3) - IHC-Prediluted
NBP2-48225 7 mL

Mouse Monoclonal pan Cytokeratin Antibody (AE1 + AE3) - IHC-Prediluted

Sign In for Pricing
View Details
KPNA2 Antibody, FITC conjugated
A27122-50UG 50 µg

KPNA2 Antibody, FITC conjugated

Sign In for Pricing
View Details
TSG-6 Polyclonal Antibody
RA35622-01 50 µL

TSG-6 Polyclonal Antibody

Sign In for Pricing
View Details