Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Levanase (sacC)

Product Specifications

Product Name Alternative

Beta-D-fructofuranosidase; Exo-beta-D-fructosidase; Exo-levanase

Abbreviation

Recombinant Bacillus subtilis sacC protein

Gene Name

SacC

UniProt

P05656

Expression Region

25-677aa

Organism

Bacillus subtilis (strain 168)

Target Sequence

ADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQYANDVPTSPWRSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTSKKWKNLTISPASHNVLAGQSGDAYEINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRNAKLFVDRSESGNDTFNPAFNTGKETAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDIILPDRSSKGLELYAANGGVKVKSLTIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Exo-fructosidase that can hydrolyze both levan and inulin, leading to the production of free fructose. Is also able to hydrolyze sucrose and to a small extent raffinose, but not melezitose, stachylose, cellobiose, maltose, and lactose.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Exo-fructosidase that can hydrolyze both levan and inulin, leading to the production of free fructose. Is also able to hydrolyze sucrose and to a small extent raffinose, but not melezitose, stachylose, cellobiose, maltose, and lactose.

Molecular Weight

77.2 kDa

References & Citations

Kinetics of the secretion of Bacillus subtilis levanase overproduced during the exponential phase of growth.Leloup L., Le Saux J., Petit-Glatron M.-F., Chambert R.Microbiology 145:613-619 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ODF2L Protein Vector (Mouse) (pPM-C-HA)
PV207696 500 ng

ODF2L Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cgm4 (NM_012525) Rat Tagged Lenti ORF Clone
RR202395L3 10 µg

Cgm4 (NM_012525) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat anti-nucleolus antibody, ANA ELISA Kit
MBS7251541-01 48 Well

Rat anti-nucleolus antibody, ANA ELISA Kit

Sign In for Pricing
View Details
Rat anti-nucleolus antibody, ANA ELISA Kit
MBS7251541-02 96 Well

Rat anti-nucleolus antibody, ANA ELISA Kit

Sign In for Pricing
View Details
Rat anti-nucleolus antibody, ANA ELISA Kit
MBS7251541-03 5x 96 Well

Rat anti-nucleolus antibody, ANA ELISA Kit

Sign In for Pricing
View Details
Rat anti-nucleolus antibody, ANA ELISA Kit
MBS7251541-04 10x 96 Well

Rat anti-nucleolus antibody, ANA ELISA Kit

Sign In for Pricing
View Details