Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus DNA polymerase catalytic subunit (BALF5), partial

Product Specifications

Product Name Alternative

BALF5DNA polymerase catalytic subunit; EC 2.7.7.7

Abbreviation

Recombinant Epstein-Barr virus BALF5 protein, partial

Gene Name

BALF5

UniProt

P03198

Expression Region

1-210aa

Organism

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Target Sequence

MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Replicates viral genomic DNA in the late phase of lytic infection, producing long concateric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Replicates viral genomic DNA in the late phase of lytic infection, producing long concatemeric DNA. The replication complex is composed of six viral proteins

Molecular Weight

39.2 kDa

References & Citations

A functional and structural basis for TCR cross-reactivity in multiple sclerosis.Lang H.L.E., Jacobsen H., Ikemizu S., Andersson C., Harlos K., Madsen L., Hjorth P., Sondergaard L., Svejgaard A., Wucherpfennig K., Stuart D.I., Bell J.I., Jones E.Y., Fugger L.Nat. Immunol. 3:940-943 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ly6c1 (NM_010741) AAV Particle
MR200746A1V 250 µL

Mouse Ly6c1 (NM_010741) AAV Particle

Sign In for Pricing
View Details
Rabbit Anti-PRDX3 Recombinant Antibody (clone 14E2)
VS4-CJ87 Each

Rabbit Anti-PRDX3 Recombinant Antibody (clone 14E2)

Sign In for Pricing
View Details
Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit
MBS2511417-01 24 Tests

Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit

Sign In for Pricing
View Details
Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit
MBS2511417-02 48 Tests

Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit

Sign In for Pricing
View Details
Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit
MBS2511417-03 96 Tests

Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit

Sign In for Pricing
View Details
Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit
MBS2511417-04 5x 96 Tests

Porcine GAD1 (Glutamate Decarboxylase 1) ELISA Kit

Sign In for Pricing
View Details