Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Centruroides noxius Beta-mammal toxin Cn2

Product Specifications

Product Name Alternative

Toxin II.9.2.2

Abbreviation

Recombinant Centruroides noxius Beta-mammal toxin Cn2 protein

UniProt

P01495

Expression Region

17-82aa

Organism

Centruroides noxius (Mexican scorpion)

Target Sequence

KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Molecular Weight

23.6 kDa

References & Citations

"Solution structure of toxin 2 from Centruroides noxius Hoffmann, a beta-scorpion neurotoxin acting on sodium channels."Pintar A., Possani L.D., Delepierre M.J. Mol. Biol. 287:359-367 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

[ (3R,3aR,6S,6aS) -3-hydroxy-2,3,3a,5,6,6a-hexahydrofuro[3,2-b]furan-6-yl] nitrate
JH164468 1 Each

[ (3R,3aR,6S,6aS) -3-hydroxy-2,3,3a,5,6,6a-hexahydrofuro[3,2-b]furan-6-yl] nitrate

Sign In for Pricing
View Details
Fluoro Catalase Activity Detection Kit by Cell Technology
FLOCAT100-3 500 Tests

Fluoro Catalase Activity Detection Kit by Cell Technology

Sign In for Pricing
View Details
TRAF4 Rabbit Polyclonal Antibody
TA330396 100 µL

TRAF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RplK Antibody
orb826581 2 mg

RplK Antibody

Sign In for Pricing
View Details
DOLK (NM_014908) Human Tagged Lenti ORF Clone
RC207095L4 10 µg

DOLK (NM_014908) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Horse Serum amyloid A protein Protein, His, Yeast-10ug
QP6647-ye-10ug 10ug

Recombinant Horse Serum amyloid A protein Protein, His, Yeast-10ug

Sign In for Pricing
View Details