Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Centruroides suffusus Beta-mammal toxin Css4

Product Specifications

Product Name Alternative

; Beta-mammal toxin Css4; Css IV; CssIV

Abbreviation

Recombinant Centruroides suffusus Beta-mammal toxin Css4 protein

UniProt

P60266

Expression Region

20-85aa

Organism

Centruroides suffusus suffusus (Mexican scorpion)

Target Sequence

KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Molecular Weight

23.6 kDa

References & Citations

Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RDH5 (NM_002905) Human Over-expression Lysate
LS005959-100ug 100 µg

RDH5 (NM_002905) Human Over-expression Lysate

Sign In for Pricing
View Details
UHRF2 Antibody (Biotin)
orb518023-01 50 µg

UHRF2 Antibody (Biotin)

Sign In for Pricing
View Details
UHRF2 Antibody (Biotin)
orb518023-02 100 µg

UHRF2 Antibody (Biotin)

Sign In for Pricing
View Details
MRPS25 AAV Vector (Human) (CMV)
30569101 1 µg

MRPS25 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GDF6, NT (GDF6, GDF16, Growth/differentiation factor 6, Growth/differentiation factor 16) (MaxLight 750) discontinued
035985-ML750 100 µL

GDF6, NT (GDF6, GDF16, Growth/differentiation factor 6, Growth/differentiation factor 16) (MaxLight 750) discontinued

Sign In for Pricing
View Details
FAIM3 (FCMR) Human Over-expression Lysate
orb1377901 20 µg

FAIM3 (FCMR) Human Over-expression Lysate

Sign In for Pricing
View Details