Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Toxocara canis 26KDA secreted antigen (TES-26)

Product Specifications

Product Name Alternative

Toxocara excretory-secretory antigen 26 ; TES-26

Abbreviation

Recombinant Toxocara canis TES-26 protein

Gene Name

TES-26

UniProt

P54190

Expression Region

22-262aa

Organism

Toxocara canis (Canine roundworm)

Target Sequence

QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds phosphatidylethanolamine.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds phosphatidylethanolamine.

Molecular Weight

41.9 kDa

References & Citations

An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELT Rabbit Polyclonal Antibody
TA339650 100 µL

HELT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRP5L (NM_182492) Human Recombinant Protein
TP311399L 1 mg

LRP5L (NM_182492) Human Recombinant Protein

Sign In for Pricing
View Details
Mecamylamine Hydrochloride 200mg
A17884-200 200 mg

Mecamylamine Hydrochloride 200mg

Sign In for Pricing
View Details
Protein Wnt-6 (WNT6) Antibody
abx412284 50 µg

Protein Wnt-6 (WNT6) Antibody

Sign In for Pricing
View Details
Zfp13 (BC052082) Mouse Tagged ORF Clone Lentiviral Particle
MR208223L4V 200 µL

Zfp13 (BC052082) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Monkey Monoclonal Monkeypox Virus A29L Antibody (0031) [Alexa Fluor 532]
NBP3-18271AF532 0.1 mL

Monkey Monoclonal Monkeypox Virus A29L Antibody (0031) [Alexa Fluor 532]

Sign In for Pricing
View Details