Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Botulinum neurotoxin type F (botF), partial

Product Specifications

Product Name Alternative

Bontoxilysin-F

Abbreviation

Recombinant Clostridium botulinum botF protein, partial

Gene Name

BotF

UniProt

P30996

Expression Region

1-436aa

Organism

Clostridium botulinum

Target Sequence

MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATRLSEVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTESDLANKFKVKCRNTYFIKYEFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQSIKLNPKIIDSIPDKGLVEKIVKFCKSVIPRK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '58-Gln-|-Lys-59' bond of synaptobrevins-1 and -2.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '58-Gln-|-Lys-59' bond of synaptobrevins-1 and -2.

Molecular Weight

53.6 kDa

References & Citations

Sequence of the gene encoding type F neurotoxin of Clostridium botulinum.East A.K., Richardson P.T., Allaway D., Collins M.D., Roberts T.A., Thompson D.E.FEMS Microbiol. Lett. 75:225-230 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf71 (NM_001080406) Human Tagged ORF Clone
RG213953 10 µg

C12orf71 (NM_001080406) Human Tagged ORF Clone

Sign In for Pricing
View Details
TTC33 Polyclonal Antibody, PE-Cy7 Conjugated
bs-9146R-PE-Cy7 100 µL

TTC33 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
SMUBP2 (IGHMBP2) (NM_002180) Human Tagged ORF Clone Lentiviral Particle
RC211261L3V 200 µL

SMUBP2 (IGHMBP2) (NM_002180) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mefenamic Acid
C17416 10 mM / 1 mL

Mefenamic Acid

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase RNF14 (RNF14)
MBS1470179-01 0.02 mg (E-Coli)

Recombinant Human E3 ubiquitin-protein ligase RNF14 (RNF14)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase RNF14 (RNF14)
MBS1470179-02 0.02 mg (Yeast)

Recombinant Human E3 ubiquitin-protein ligase RNF14 (RNF14)

Sign In for Pricing
View Details