Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Protein prgI (prgI)

Product Specifications

Product Name Alternative

PrgI; STM2873; Protein PrgI

Abbreviation

Recombinant Salmonella typhimurium prgI protein

Gene Name

PrgI

UniProt

P41784

Expression Region

1-80aa

Organism

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Target Sequence

MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Required for invasion of epithelial cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for invasion of epithelial cells.

Molecular Weight

24.9 kDa

References & Citations

Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. , Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC3 Rabbit Monoclonal Antibody [Clone ID: 24GB1940]
TA425262S 20 µL

TACC3 Rabbit Monoclonal Antibody [Clone ID: 24GB1940]

Sign In for Pricing
View Details
EML5 Protein Vector (Mouse) (pPB-C-His)
PV175550 500 ng

EML5 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human FGF9 Protein, N-Fc
bs-103094P-01 20 µg

Recombinant Human FGF9 Protein, N-Fc

Sign In for Pricing
View Details
Recombinant Human FGF9 Protein, N-Fc
bs-103094P-02 50 µg

Recombinant Human FGF9 Protein, N-Fc

Sign In for Pricing
View Details
Lentiviral mouse Slc35f4 shRNA (UAS) - Lentiviral mouse Slc35f4 shRNA (UAS, iRFP) (100)
GTR15136659 1 Vial

Lentiviral mouse Slc35f4 shRNA (UAS) - Lentiviral mouse Slc35f4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TMEM108 sgRNA CRISPR Lentivector (Human) (Target 2)
K2396503 1.0 µg DNA

TMEM108 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details