Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Protein prgI (prgI)

Product Specifications

Product Name Alternative

PrgI; STM2873; Protein PrgI

Abbreviation

Recombinant Salmonella typhimurium prgI protein

Gene Name

PrgI

UniProt

P41784

Expression Region

1-80aa

Organism

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Target Sequence

MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Required for invasion of epithelial cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for invasion of epithelial cells.

Molecular Weight

24.9 kDa

References & Citations

Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. , Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC6A11 qPCR Primer Pair
QH22769S 200 Tests

Human SLC6A11 qPCR Primer Pair

Sign In for Pricing
View Details
Guanylate Cyclase alpha-2, Soluble, NT (Guanylate Cyclase Soluble Subunit alpha-2, Guanylate Cyclase 1 Soluble alpha 2, GCS-alpha-2, GC-SA2, GUC1A2, GUCSA2, GUCY1A2) (AP) discontinued
G9804-47A-AP 200 µL

Guanylate Cyclase alpha-2, Soluble, NT (Guanylate Cyclase Soluble Subunit alpha-2, Guanylate Cyclase 1 Soluble alpha 2, GCS-alpha-2, GC-SA2, GUC1A2, GUCSA2, GUCY1A2) (AP) discontinued

Sign In for Pricing
View Details
Human Contactin 5 / CNTN5 ELISA Kit
NS-E10052-01 1 Each

Human Contactin 5 / CNTN5 ELISA Kit

Sign In for Pricing
View Details
Human Contactin 5 / CNTN5 ELISA Kit
NS-E10052-02 1 Each

Human Contactin 5 / CNTN5 ELISA Kit

Sign In for Pricing
View Details
Anti-CD11b Antibody (5B108)
TMAC-00649-01 50 μL

Anti-CD11b Antibody (5B108)

Sign In for Pricing
View Details
Anti-CD11b Antibody (5B108)
TMAC-00649-02 100 µL

Anti-CD11b Antibody (5B108)

Sign In for Pricing
View Details