Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

Product Specifications

Product Name Alternative

7KDA DNA-binding protein dSso7d

Abbreviation

Recombinant Sulfolobus solfataricus sso7d protein

Gene Name

Sso7d

UniProt

P39476

Expression Region

2-64aa

Organism

Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

Target Sequence

ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity) . Stimulates the Holliday junction cleavage activity of Hjc

Molecular Weight

23.1 kDa

References & Citations

The complete genome of the crenarchaeon Sulfolobus solfataricus P2.She Q., Singh R.K., Confalonieri F., Zivanovic Y., Allard G., Awayez M.J., Chan-Weiher C.C.-Y., Clausen I.G., Curtis B.A., De Moors A., Erauso G., Fletcher C., Gordon P.M.K., Heikamp-de Jong I., Jeffries A.C., Kozera C.J., Medina N., Peng X. , Thi-Ngoc H.P., Redder P., Schenk M.E., Theriault C., Tolstrup N., Charlebois R.L., Doolittle W.F., Duguet M., Gaasterland T., Garrett R.A., Ragan M.A., Sensen C.W., Van der Oost J.Proc. Natl. Acad. Sci. U.S.A. 98:7835-7840 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Nudel (NDEL1) Mouse Monoclonal Antibody [Clone ID: OTI1G10]
M02478-1 100 µL

Anti-Nudel (NDEL1) Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Human TNFSF10 Pre-designed siRNA Set B
SI017094B 1 Each

Human TNFSF10 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)
TRV-0008074-01 10 µg

Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)

Sign In for Pricing
View Details
Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)
TRV-0008074-02 50 µg

Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)

Sign In for Pricing
View Details
Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)
TRV-0008074-03 100 µg

Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)

Sign In for Pricing
View Details
Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)
TRV-0008074-04 200 µg

Recombinant Chemokine C-X-C-Motif Receptor 3 (CXCR3)

Sign In for Pricing
View Details