Recombinant Saccharomyces cerevisiae GTP-binding nuclear protein GSP1/CNR1 (GSP1)
Product Specifications
Product Name Alternative
Chromosome stability protein 17GTPase Ran homologGenetic suppressor of PRP20-1
Abbreviation
Recombinant Saccharomyces cerevisiae GSP1 protein
Gene Name
GSP1
UniProt
P32835
Expression Region
2-219aa
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Sequence
SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
Tag
N-terminal 6xHis-SUMO-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Others
Relevance
GTP-binding protein involved in nucleoCytoplasmic domain transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.
Molecular Weight
40.7 kDa
References & Citations
Cex1p is a novel Cytoplasmic domain component of the Saccharomyces cerevisiae nuclear tRNA export machinery.McGuire A.T., Mangroo D.EMBO J. 26:288-300 (2007)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400054-100 1x 100 µL
HCG-beta (HCGb/54), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470891-500 1x 500 µL
Mucin 6 (MUC6) (CLH5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details