Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B
Product Specifications
Product Name Alternative
Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1
Abbreviation
Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B protein
UniProt
P38949
Expression Region
2-160aa
Organism
Carpinus betulus (European hornbeam) (Carpinus caucasica)
Target Sequence
GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Others
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
21.3 kDa
References & Citations
PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam.Nedergaard Larsen J., Stroeman P., Ipsen H.Mol. Immunol. 29:703-711 (1992)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402981-500 1x 500 µL
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040635-100 1x 100 µL
Von Willebrand Factor (VWF635), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882889-500 1x 500 µL
Secretory Component / ECM1 (ECM1/2889R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details