Recombinant Hepatitis E virus genotype 1 Non-structural polyprotein pORF1 (ORF1), partial

ORF1; Non-structural polyprotein pORF1 [Includes: Methyltransferase; EC 2.1.1.-; EC 2.7.7.-) ; Putative papain-like cysteine protease; PLP; EC 3.4.22.-) ; NTPase/helicase; EC 3.6.4.-) ; RNA-directed RNA polymerase; RdRp; EC 2.7.7.48) ]

EVFWNHPIQRVIHNELELYCRARSGRCLEIGAHPRSINDNPNVVHRCFLRPAGRDVQRWYTAPTRGPAANCRRSALRGLPAADRTYCFDGFSGCNFPAETGIALYSLHDMSPSDVAEAMFRHGMTRLYAALHLPPEVLLPPGTYRTASYLLIHDGRRVVVTYEGDTSAGYNHDVSNLRSWI

Methyltransferase displays a Cytoplasmic domain capping enzyme activity. This function is necessary since all viral RNAs are synthesized in the cytoplasm, and host capping enzymes are restricted to the nucleus. The enzymatic reaction involves a covalent link between 7-methyl-GMP and the methyltransferase, whereas eukaryotic capping enzymes form a covalent complex only with GMP. Methyltransferase catalyzes transfer of a methyl group from S-adenosylmethionine to GTP and GDP to yield m7GTP or m7GDP. GMP, GpppG, and GpppA were poor substrates for the methyltransferase. This enzyme also displays guanylyltransferase activity to form a covalent complex, methyltransferase-m7GMP, from which 7-methyl-GMP is transferred to the mRNA to create the cap structure. Cap analogs such as m7GTP, m7GDP, et2m7GMP, and m2et7GMP inhibit the methyltransferase reaction .RNA-directed RNA polymerase plays an essential role in the virus replication. Binds to the 3'-end of the genomic RNA, probably to initiate replication ..

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Methyltransferase displays a cytoplasmic capping enzyme activity. This function is necessary since all viral RNAs are synthesized in the cytoplasm, and host capping enzymes are restricted to the nucleus. The enzymatic reaction involves a covalent link between 7-methyl-GMP and the methyltransferase, whereas eukaryotic capping enzymes form a covalent complex only with GMP. Methyltransferase catalyzes transfer of a methyl group from S-adenosylmethionine to GTP and GDP to yield m (7) GTP or m (7) GDP. GMP, GpppG, and GpppA were poor substrates for the methyltransferase. This enzyme also displays guanylyltransferase activity to form a covalent complex, methyltransferase-m (7) GMP, from which 7-methyl-GMP is transferred to the mRNA to create the cap structure. Cap analogs such as m (7) GTP, m (7) GDP, et (2) m (7) GMP, and m (2) et (7) GMP inhibit the methyltransferase reaction (By similarity) .

Characterization of a prototype strain of hepatitis E virus.Tsarev S.A., Emerson S.U., Reyes G.R., Tsareva T.S., Legters L.J., Malik I.A., Iqbal M., Purcell R.H.Proc. Natl. Acad. Sci. U.S.A. 89:559-563 (1992)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.