Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Regenerating islet-derived protein 3-beta (Reg3b)

Product Specifications

Product Name Alternative

Pancreatitis-associated protein 1; Peptide 23REG-2Regenerating islet-derived protein III-beta ; Reg III-beta

Abbreviation

Recombinant Rat Reg3b protein

Gene Name

Reg3b

UniProt

P25031

Expression Region

27-175aa

Organism

Rattus norvegicus (Rat)

Target Sequence

EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues (By similarity) .

Molecular Weight

20.6 kDa

References & Citations

Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis.Iovanna J., Orelle B., Keim V., Dagorn J.-C.J. Biol. Chem. 266:24664-24669 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1440 siRNA Oligos set (Mouse)
32873174 3x 5 nmol

Olfr1440 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
KIF17 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-3527R-BF350 100 µL

KIF17 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ACO1 ELISA Kit (Rat)
OKEH02340-96W 96 Tests

ACO1 ELISA Kit (Rat)

Sign In for Pricing
View Details
Prepro-ANP (104-116) (Human) - Purified IgG Antibody
G-005-21 400 µg

Prepro-ANP (104-116) (Human) - Purified IgG Antibody

Sign In for Pricing
View Details
Anti-HADHA Rabbit Monoclonal Antibody
MA2942-.1 100 µL

Anti-HADHA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HP1Beta Monoclonal Antibody
JOT-MCA0733-01 20 µL

HP1Beta Monoclonal Antibody

Sign In for Pricing
View Details