Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx (vpx)

Product Specifications

Product Name Alternative

Viral protein XX ORF protein

Abbreviation

Recombinant Human immunodeficiency virus type 2 subtype A vpx protein

Gene Name

Vpx

UniProt

P18099

Expression Region

1-113aa

Organism

Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2)

Target Sequence

MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Molecular Weight

17.2 kDa

References & Citations

The Vpx lentiviral accessory protein targets SAMHD1 for degradation in the nucleus.Hofmann H., Logue E.C., Bloch N., Daddacha W., Polsky S.B., Schultz M.L., Kim B., Landau N.R.J. Virol. 86:12552-12560 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Fam71e1 shRNA (UAS) - Lentiviral mouse Fam71e1 shRNA (UAS) (100)
GTR15160914 1 Vial

Lentiviral mouse Fam71e1 shRNA (UAS) - Lentiviral mouse Fam71e1 shRNA (UAS) (100)

Ask
View Details
Recombinant Dengue Virus Dengue Envelope-1 22kDa Protein, His, E.coli-100ug
QP11623-100ug 100ug

Recombinant Dengue Virus Dengue Envelope-1 22kDa Protein, His, E.coli-100ug

Ask
View Details
FABP9 Antibody
KC-1465-01 50 μL

FABP9 Antibody

Ask
View Details
FABP9 Antibody
KC-1465-02 100 µL

FABP9 Antibody

Ask
View Details
FABP9 Antibody
KC-1465-03 1 mL

FABP9 Antibody

Ask
View Details
DEAF1 siRNA (Rat)
CRR2480-01 15 nmol

DEAF1 siRNA (Rat)

Ask
View Details