Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Simian immunodeficiency virus Protein Vpx (vpx)

Product Specifications

Product Name Alternative

Viral protein XX ORF protein

Abbreviation

Recombinant Simian immunodeficiency virus vpx protein

Gene Name

Vpx

UniProt

P19508

Expression Region

1-112aa

Organism

Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey)

Target Sequence

MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.

Molecular Weight

28.9 kDa

References & Citations

Structural basis of lentiviral subversion of a cellular protein degradation pathway.Schwefel D., Groom H.C., Boucherit V.C., Christodoulou E., Walker P.A., Stoye J.P., Bishop K.N., Taylor I.A.Nature 505:234-238 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copper(II) Acetylacetonate
TRC-C685433-250MG 250 mg

Copper(II) Acetylacetonate

Sign In for Pricing
View Details
Bisphenol S Disulfate
TRC-B964950-5MG 5 mg

Bisphenol S Disulfate

Sign In for Pricing
View Details
a-Naphthyl Glycidyl Ether, 90%
TRC-N378400-5G 5 g

a-Naphthyl Glycidyl Ether, 90%

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lymphoid tissue
CB522916 1 Block

Frozen Tissue Blocks, Lymphoid tissue

Sign In for Pricing
View Details
WIPI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8F9]
TA811578BM 100 µL

WIPI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8F9]

Sign In for Pricing
View Details
VEGFR2 / Flk-1 / KDR3 / CD309 (KDR721), CF647 conjugate, 0.1mg/mL
BNC470721-100 1x 100 µL

VEGFR2 / Flk-1 / KDR3 / CD309 (KDR721), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details