What sizes are available for Recombinant Zaire ebolavirus Nucleoprotein (NP), partial?

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is available in the following size(s): 50 µg, 200 µg, 500 µg, 10 µg, 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Zaire ebolavirus Nucleoprotein (NP), partial come in?

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is available in 7 different pack sizes.

Who manufactures Recombinant Zaire ebolavirus Nucleoprotein (NP), partial?

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Zaire ebolavirus Nucleoprotein (NP), partial?

Estimated delivery time for Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is approximately 15 business day(s), depending on your location.

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial

Q: What is the catalog number for Recombinant Zaire ebolavirus Nucleoprotein (NP), partial?

The catalog number for Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is CSB-EP323576ZAB.

Product Specifications

Product Name Alternative

Nucleocapsid protein ; Protein N

Abbreviation

Recombinant Zaire ebolavirus NP protein, partial

Gene Name

UniProt

P18272

Expression Region

488-739aa

Organism

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Target Sequence

LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as tplate for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.

Molecular Weight

33.1 kDa

References & Citations

Mapping of the VP40-binding regions of the nucleoprotein of Ebola virus.Noda T., Watanabe S., Sagara H., Kawaoka Y.J. Virol. 81:3554-3562 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.