Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial

Product Specifications

Product Name Alternative

MHC class I antigen E

Abbreviation

Recombinant Human HLA-E protein, partial

Gene Name

HLA-E

UniProt

P13747

Expression Region

22-305aa

Organism

Homo sapiens (Human)

Target Sequence

GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Molecular Weight

48.7 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 Antibody [OKT4]
76-319 0.1 mg

CD4 Antibody [OKT4]

Sign In for Pricing
View Details
CHO Monoclonal IL-33 Antibody (etokimab) - Humanized - (Dry Ice)
NBP3-28358-50ug 50 µg

CHO Monoclonal IL-33 Antibody (etokimab) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
Angiospermae, Detail Set, Leaves, 15 microscope slides
78200 15 x 11 x 4 cm

Angiospermae, Detail Set, Leaves, 15 microscope slides

Sign In for Pricing
View Details
Phospho-MNK1 (Thr385) ELISA Kit
EKA51681 192 Tests

Phospho-MNK1 (Thr385) ELISA Kit

Sign In for Pricing
View Details
pCMV-SPORT6-Fads1 Plasmid
PVT44567 2 µg

pCMV-SPORT6-Fads1 Plasmid

Sign In for Pricing
View Details
3R-Hydroxycapric Acid
TRC-H357865-250MG 250 mg

3R-Hydroxycapric Acid

Sign In for Pricing
View Details