Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Major urinary protein 2 (Mup2)

Product Specifications

Product Name Alternative

Mup2; Major urinary protein 2; MUP 2

Abbreviation

Recombinant Mouse Mup2 protein

Gene Name

Mup2

UniProt

P11589

Expression Region

19-180aa

Organism

Mus musculus (Mouse)

Target Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Molecular Weight

22.7 kDa

References & Citations

Complete 1H, 15N and 13C assignment of a recombinant mouse major urinary protein.Abbate F., Franzoni L., Lohr F., Luecke C., Ferrari E., Sorbi R.T., Rueterjans H., Spisni A.J. Biomol. NMR 15:187-188 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®640R Arachis hypogaea Lectin PNA (Peanut)
#29063 1x 1 mg

CF®640R Arachis hypogaea Lectin PNA (Peanut)

Sign In for Pricing
View Details
CENTB1 (ACAP1) (N-term) Rabbit Polyclonal Antibody
AP50038PU-N 400 µL

CENTB1 (ACAP1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Noscapine Hydrochloride
TRC-N882018-1G 1 g

Noscapine Hydrochloride

Sign In for Pricing
View Details
LAPTM5 (NM_006762) Human Recombinant Protein
TP317813 20 µg

LAPTM5 (NM_006762) Human Recombinant Protein

Sign In for Pricing
View Details
(3Beta)-3-Hydroxypregna-5,14,16-trien-20-one
TRC-H952280-1MG 1 mg

(3Beta)-3-Hydroxypregna-5,14,16-trien-20-one

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB628755 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details