Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C4-B (C4B), partial

Product Specifications

Product Name Alternative

Basic complement C4C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3

Abbreviation

Recombinant Human C4B protein, partial

Gene Name

C4B

UniProt

P0C0L5

Expression Region

1454-1744aa

Organism

Homo sapiens (Human)

Target Sequence

EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complent pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.Derived from proteolytic degradation of complent C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.; FUNCTION

Molecular Weight

49.1 kDa

References & Citations

Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.J. Proteome Res. 5:1493-1503 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)
MBS2080349-01 0.1 mL

PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)
MBS2080349-02 0.2 mL

PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)
MBS2080349-03 0.5 mL

PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)
MBS2080349-04 1 mL

PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)
MBS2080349-05 5 mL

PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)
MBS2080349-06 5x 5 mL

PE-Linked Polyclonal Antibody to Inter Alpha-Globulin Inhibitor H3 (ITIH3)

Sign In for Pricing
View Details