Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2

Product Specifications

Product Name Alternative

Major allergen Api g 1; isoallergen 2; Allergen Api g 1.0201; allergen Api g 1

Abbreviation

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2 protein

UniProt

P92918

Expression Region

1-159aa

Organism

Apium graveolens (Celery)

Target Sequence

MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.1 kDa

References & Citations

Characterization of Api g 1.0201, a new member of the Api g 1 family of Celery Allergens.Hoffmann-Sommergruber K., Ferris R., Pec M., Radauer G., O'Riordain G., Camara-Machado O., Scheiner O., Breiteneder H.Int. Arch. Allergy Immunol. 122:115-123 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Siah2 AAV siRNA Pooled Vector
43744166 1.0 µg

Siah2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Prss33 Pre-designed siRNA Set B
SI111264B 1 Each

Mouse Prss33 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Adenine Nucleotide Translocator 2 Overexpression Lysate (Native) - (Dry Ice)
NBL1-16073 0.1 mg

Adenine Nucleotide Translocator 2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Anks6 Mouse Gene Knockout Kit (CRISPR)
KN501310 1 Kit

Anks6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kallikrein 15 (KLK15) (NM_138563) Human Tagged Lenti ORF Clone
RC223726L4 10 µg

Kallikrein 15 (KLK15) (NM_138563) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (FITC)
MBS6458244-01 0.2 mL

POLD2 (DNA Polymerase delta Subunit 2, DNA Polymerase delta Subunit p50, POLD2) (FITC)

Sign In for Pricing
View Details