Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dactylis glomerata Pollen allergen Dac g 3, partial

Product Specifications

Product Name Alternative

Pollen allergen Dac g 3; Allergen Dac g III; allergen Dac g 3; Fragment

Abbreviation

Recombinant Dactylis glomerata Pollen allergen Dac g 3 protein, partial

UniProt

P93124

Expression Region

1-96aa

Organism

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Target Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.9 kDa

References & Citations

Cloning, sequencing and immunological characterization of Dac g 3, a major allergen from Dactylis glomerata pollen.Guerin-Marchand C., Senechal H., Bouin A.P., Leduc-Brodard V., Taudou G., Weyer A., Peltre G., David B.Mol. Immunol. 33:797-806 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Placenta-specific protein 9 (Plac9)
MBS1409636-01 0.02 mg (E-Coli)

Recombinant Mouse Placenta-specific protein 9 (Plac9)

Sign In for Pricing
View Details
Recombinant Mouse Placenta-specific protein 9 (Plac9)
MBS1409636-02 0.1 mg (E-Coli)

Recombinant Mouse Placenta-specific protein 9 (Plac9)

Sign In for Pricing
View Details
Recombinant Mouse Placenta-specific protein 9 (Plac9)
MBS1409636-03 0.02 mg (Yeast)

Recombinant Mouse Placenta-specific protein 9 (Plac9)

Sign In for Pricing
View Details
Recombinant Mouse Placenta-specific protein 9 (Plac9)
MBS1409636-04 0.1 mg (Yeast)

Recombinant Mouse Placenta-specific protein 9 (Plac9)

Sign In for Pricing
View Details
Recombinant Mouse Placenta-specific protein 9 (Plac9)
MBS1409636-05 0.02 mg (Baculovirus)

Recombinant Mouse Placenta-specific protein 9 (Plac9)

Sign In for Pricing
View Details
Recombinant Mouse Placenta-specific protein 9 (Plac9)
MBS1409636-06 1 mg (E-Coli)

Recombinant Mouse Placenta-specific protein 9 (Plac9)

Sign In for Pricing
View Details