Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Echis carinatus Disintegrin EC3B

Product Specifications

Product Name Alternative

Disintegrin EC3B

Abbreviation

Recombinant Echis carinatus Disintegrin EC3B protein

UniProt

P81631

Expression Region

1-67aa

Organism

Echis carinatus (Saw-scaled viper)

Target Sequence

NSVHPCCDPVKCEPREGEHCISGPCCRNCKFLNAGTICKRAMLDGLNDYCTGISTDCPRNRYKGKED

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1) . It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits adhesion of cells expressing alpha-4/beta-1 (ITGA4/ITGB1) and alpha-4/beta-7 (ITGA4/ITGB7) integrins to the natural ligands vascular cell adhesion molecule 1 (VCAM-1) and mucosal addressin cell adhesion molecule 1 (MADCAM-1) . It is also a weaker inhibitor of alpha-5/beta-1 (ITGA5/ITGB1) and alpha-2b/beta-3 (ITGA2B/ITGB3) integrins. The inhibitory activity of EC3 towards alpha-4 integrins is associated with the MLD sequence of EC3B subunit. The ability of EC3 to inhibit ITGA5/ITGB1 resides in both subunits A and B.

Molecular Weight

23.4 kDa

References & Citations

EC3, a novel heterodimeric disintegrin from Echis carinatus venom, inhibits alpha4 and alpha5 integrins in an RGD-independent manner.Marcinkiewicz C., Calvete J.J., Marcinkiewicz M.M., Raida M., Vijay-Kumar S., Huang Z., Lobb R.R., Niewiarowski S.J. Biol. Chem. 274:12468-12473 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTBP1 (NM_001328) Human Over-expression Lysate
LC400528 20 µg

CTBP1 (NM_001328) Human Over-expression Lysate

Sign In for Pricing
View Details
CNOT1 Rabbit Polyclonal Antibody
TA374925 100 µL

CNOT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CGNL1 Human Gene Knockout Kit (CRISPR)
KN423121 1 Kit

CGNL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Crisp3 Mouse Gene Knockout Kit (CRISPR)
KN503832 1 Kit

Crisp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Anti-STA Antibody
BAL-4701-2 2 mL

Biotin Conjugated Rabbit Anti-STA Antibody

Sign In for Pricing
View Details
Valeraldehyde (Pentanal)
TRC-V091295-250MG 250 mg

Valeraldehyde (Pentanal)

Sign In for Pricing
View Details