Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 155 (ZNF155)

Product Specifications

Product Name Alternative

ZNF155; Zinc finger protein 155

Abbreviation

Recombinant Human ZNF155 protein

Gene Name

ZNF155

UniProt

Q12901

Expression Region

1-538aa

Organism

Homo sapiens (Human)

Target Sequence

MTTFKEAVTFKDVAVVFTEEELGLLDPAQRKLYRDVMLENFRNLLSVGHQPFHQDTCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSISDVPIFDLPQQLYSEEKSYTCDECGKSICYISALHVHQRVHVGEKLFMCDVCGKEFSQSSHLQTHQRVHTGEKPFKCEQCGKGFSRRSALNVHRKLHTGEKPYICEACGKAFIHDSQLKEHKRIHTGEKPFKCDICGKTFYFRSRLKSHSMVHTGEKPFRCDTCDKSFHQRSALNRHCMVHTGEKPYRCEQCGKGFIGRLDFYKHQVVHTGEKPYNCKECGKSFRWSSCLLNHQRVHSGEKSFKCEECGKGFYTNSQLSSHQRSHSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRASSILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRRYKRRLNLDILLSLFLNDT

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

May be involved in transcriptional regulation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in transcriptional regulation.

Molecular Weight

78.1 kDa

References & Citations

The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF740 conjugate, 0.1mg/mL
BNC742445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4,4’-Oxydibenzenesulfonyl Chloride
TRC-O870630-1G 1 g

4,4’-Oxydibenzenesulfonyl Chloride

Sign In for Pricing
View Details
ANXA6 Recombinant Rabbit Monoclonal Antibody [PSH05-82]
HA722481 100 µL

ANXA6 Recombinant Rabbit Monoclonal Antibody [PSH05-82]

Sign In for Pricing
View Details
Psrc1 Mouse Gene Knockout Kit (CRISPR)
KN514142 1 Kit

Psrc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG2b,  15nm
GM-402-15 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG2b, 15nm

Sign In for Pricing
View Details
LKB1 (STK11) Human Gene Knockout Kit (CRISPR)
KN202885LP 1 Kit

LKB1 (STK11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details