Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein yippee-like 3 (YPEL3)

Product Specifications

Product Name Alternative

Protein yippee-like 3; Small ubiquitinated apoptotic protein; Yippee like 3; Yippee-like 3 (Drosophila) ; Ypel3; YPEL3_HUMAN

Abbreviation

Recombinant Human YPEL3 protein

Gene Name

YPEL3

UniProt

P61236

Expression Region

1-119aa

Organism

Homo sapiens (Human)

Target Sequence

MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Involved in proliferation and apoptosis in myeloid precursor cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in proliferation and apoptosis in myeloid precursor cells.

Molecular Weight

29.6 kDa

References & Citations

Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.Hosono K., Sasaki T., Minoshima S., Shimizu N.Gene 340:31-43 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Uroplakin IIIB Antibody (UPK3B/8550R) [PerCP]
NBP3-20914PCP 0.1 mL

Rabbit Monoclonal Uroplakin IIIB Antibody (UPK3B/8550R) [PerCP]

Sign In for Pricing
View Details
SIGLEC14 Polyclonal Antibody
MBS2517374-01 0.02 mL

SIGLEC14 Polyclonal Antibody

Sign In for Pricing
View Details
SIGLEC14 Polyclonal Antibody
MBS2517374-02 0.06 mL

SIGLEC14 Polyclonal Antibody

Sign In for Pricing
View Details
SIGLEC14 Polyclonal Antibody
MBS2517374-03 0.12 mL

SIGLEC14 Polyclonal Antibody

Sign In for Pricing
View Details
SIGLEC14 Polyclonal Antibody
MBS2517374-04 0.2 mL

SIGLEC14 Polyclonal Antibody

Sign In for Pricing
View Details
SIGLEC14 Polyclonal Antibody
MBS2517374-05 5x 0.2 mL

SIGLEC14 Polyclonal Antibody

Sign In for Pricing
View Details