What is the catalog number for Recombinant Human Protein yippee-like 1 (YPEL1)?

The catalog number for Recombinant Human Protein yippee-like 1 (YPEL1) is CSB-EP026270HU.

What sizes are available for Recombinant Human Protein yippee-like 1 (YPEL1)?

Recombinant Human Protein yippee-like 1 (YPEL1) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Protein yippee-like 1 (YPEL1) come in?

Recombinant Human Protein yippee-like 1 (YPEL1) is available in 3 different pack sizes.

Is Recombinant Human Protein yippee-like 1 (YPEL1) in stock?

Recombinant Human Protein yippee-like 1 (YPEL1) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Protein yippee-like 1 (YPEL1)?

Recombinant Human Protein yippee-like 1 (YPEL1) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Protein yippee-like 1 (YPEL1)?

Estimated delivery time for Recombinant Human Protein yippee-like 1 (YPEL1) is approximately 15 business day(s), depending on your location.

Recombinant Human Protein yippee-like 1 (YPEL1)

Product Specifications

Product Name Alternative

DiGeorge Syndrome-Related Protein; Protein yippee-like 1; Yippee (Drosophila) Homolog-Like 1; Yippee-Like 1 (Drosophila) ; YPEL1; YPEL1_HUMAN

Abbreviation

Recombinant Human YPEL1 protein

Gene Name

YPEL1

UniProt

O60688

Expression Region

1-119aa

Organism

Homo sapiens (Human)

Target Sequence

MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in epithelioid conversion of fibroblasts.

Molecular Weight

29.6 kDa

References & Citations

Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.Hosono K., Sasaki T., Minoshima S., Shimizu N.Gene 340:31-43 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.