Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vascular endothelial growth factor C (Vegfc)

Product Specifications

Product Name Alternative

Flt4 ligand ; Flt4-LVascular endothelial growth factor-related protein ; VRP

Abbreviation

Recombinant Mouse Vegfc protein

Gene Name

Vegfc

UniProt

P97953

Expression Region

108-223aa

Organism

Mus musculus (Mouse)

Target Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systs during bryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates KDR/VEGFR2 and FLT4/VEGFR3 receptors.

Molecular Weight

17 kDa

References & Citations

VEGF-C receptor binding and pattern of expression with VEGFR-3 suggests a role in lymphatic vascular development.Kukk E., Lymboussaki A., Taira S., Kaipainen A., Jeltsch M., Joukov V., Alitalo K.Development 122:3829-3837 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MiaB Antibody
orb821286 2 mg

MiaB Antibody

Sign In for Pricing
View Details
Rabbit Cervical Epithelial Cells
ARP0793 0.5 Million

Rabbit Cervical Epithelial Cells

Sign In for Pricing
View Details
Lentiviral mouse Phf2 shRNA (UAS) - Lentiviral mouse Phf2 shRNA (UAS, RFP) plasmid
GTR15267205 1 Vial

Lentiviral mouse Phf2 shRNA (UAS) - Lentiviral mouse Phf2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human NuP62CL Recombinant Protein
PROTQ9H1M0-100ug 100 µg

Human NuP62CL Recombinant Protein

Sign In for Pricing
View Details
Prrxl1 AAV siRNA Pooled Vector
37827164 1.0 µg

Prrxl1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TFAP2B (Transcription Factor AP-2-beta, AP2-beta, Activating Enhancer-binding Protein 2-beta, MGC21381) (MaxLight 405) discontinued
134351-ML405 100 µL

TFAP2B (Transcription Factor AP-2-beta, AP2-beta, Activating Enhancer-binding Protein 2-beta, MGC21381) (MaxLight 405) discontinued

Sign In for Pricing
View Details