Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Rabbit VEGFA protein

Gene Name

VEGFA

UniProt

XP_002714743.1

Expression Region

51-511aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

65.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog GDF5 (Growth Differentiation Factor 5) ELISA Kit
ELK8597-01 48 Tests

Dog GDF5 (Growth Differentiation Factor 5) ELISA Kit

Sign In for Pricing
View Details
Dog GDF5 (Growth Differentiation Factor 5) ELISA Kit
ELK8597-02 96 Tests

Dog GDF5 (Growth Differentiation Factor 5) ELISA Kit

Sign In for Pricing
View Details
Dog GDF5 (Growth Differentiation Factor 5) ELISA Kit
ELK8597-03 5x 96 Tests

Dog GDF5 (Growth Differentiation Factor 5) ELISA Kit

Sign In for Pricing
View Details
F11R Protein Vector (Rat) (pPM-C-HA)
PV266900 500 ng

F11R Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NAP1L5 (Nucleosome Assembly Protein 1-Like 5)
486532 100 µL

NAP1L5 (Nucleosome Assembly Protein 1-Like 5)

Sign In for Pricing
View Details
TCEA2 Antibody - N-terminal region : HRP (ARP58182_P050-HRP)
ARP58182_P050-HRP 100 µL

TCEA2 Antibody - N-terminal region : HRP (ARP58182_P050-HRP)

Sign In for Pricing
View Details