Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vesicle-associated membrane protein 7 (VAMP7), partial

Product Specifications

Product Name Alternative

Synaptobrevin-like protein 1Tetanus-insensitive VAMP ; Ti-VAMP

Abbreviation

Recombinant Human VAMP7 protein, partial

Gene Name

VAMP7

UniProt

P51809

Expression Region

2-186aa

Organism

Homo sapiens (Human)

Target Sequence

AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Cycle

Relevance

Involved in the targeting and/or fusion of transport vesicles to their target mbrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.

Molecular Weight

25 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Cytoplasmic Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Myc Antibody
F47612-0.4ML 0.4 mL

Myc Antibody

Ask
View Details
Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)
MBS2091269-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)
MBS2091269-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)
MBS2091269-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)
MBS2091269-04 1 mL

Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)

Ask
View Details
Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)
MBS2091269-05 5 mL

Biotin-Linked Monoclonal Antibody to Immunoglobulin G2a (IgG2a)

Ask
View Details