Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2)

Product Specifications

Product Name Alternative

DDVit 1Enterocyte differentiation-associated factor 1 ; EDAF-1Enterocyte differentiation-promoting factor 1 ; EDPF-1MMS2 homologVitamin D3-inducible protein

Abbreviation

Recombinant Human UBE2V2 protein

Gene Name

UBE2V2

UniProt

Q15819

Expression Region

2-145aa

Organism

Homo sapiens (Human)

Target Sequence

AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

Molecular Weight

32.2 kDa

References & Citations

"The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines."David Y., Ziv T., Admon A., Navon A.J. Biol. Chem. 285:8595-8604 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TLR2 Antibody
E19-7521-1 50ug/50ul

TLR2 Antibody

Ask
View Details
Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2145609-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Ask
View Details
Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2145609-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Ask
View Details
Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2145609-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Ask
View Details
Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2145609-04 1 mL

Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Ask
View Details
Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)
MBS2145609-05 5 mL

Cy3-Linked Monoclonal Antibody to Major Basic Protein (MBP)

Ask
View Details