Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transthyretin (Ttr)

Product Specifications

Product Name Alternative

Prealbumin

Abbreviation

Recombinant Mouse Ttr protein

Gene Name

Ttr

UniProt

P07309

Expression Region

21-147aa

Organism

Mus musculus (Mouse)

Target Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Molecular Weight

26.6 kDa

References & Citations

Human-murine transthyretin heterotetramers are kinetically stable and non-amyloidogenic. A lesson in the generation of transgenic models of diseases involving oligomeric proteins.Reixach N., Foss T.R., Santelli E., Pascual J., Kelly J.W., Buxbaum J.N.J. Biol. Chem. 283:2098-2107 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF-BB, Recombinant, Human, Animal Free (Platelet-Derived Growth Factor BB, Glioma-Derived Growth Factor, GDGF, Osteosarcoma-Derived Growth Factor, ODGF) discontinued
208685-01 2 µg

PDGF-BB, Recombinant, Human, Animal Free (Platelet-Derived Growth Factor BB, Glioma-Derived Growth Factor, GDGF, Osteosarcoma-Derived Growth Factor, ODGF) discontinued

Sign In for Pricing
View Details
PDGF-BB, Recombinant, Human, Animal Free (Platelet-Derived Growth Factor BB, Glioma-Derived Growth Factor, GDGF, Osteosarcoma-Derived Growth Factor, ODGF) discontinued
208685-02 10 µg

PDGF-BB, Recombinant, Human, Animal Free (Platelet-Derived Growth Factor BB, Glioma-Derived Growth Factor, GDGF, Osteosarcoma-Derived Growth Factor, ODGF) discontinued

Sign In for Pricing
View Details
Anti-CD34 Polyclonal Antibody
HB766014-01 50 µg

Anti-CD34 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD34 Polyclonal Antibody
HB766014-02 100 µg

Anti-CD34 Polyclonal Antibody

Sign In for Pricing
View Details
TXNRD1 Rabbit Polyclonal Antibody
MBS9465456-01 0.05 mL

TXNRD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TXNRD1 Rabbit Polyclonal Antibody
MBS9465456-02 0.1 mL

TXNRD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details