Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 2 ; TNF-R2Tumor necrosis factor receptor type II ; TNF-RII ; TNFR-IIp75p80 TNF-alpha receptor; CD120bINN: Etanercept

Abbreviation

Recombinant Human TNFRSF1B protein, partial

Gene Name

TNFRSF1B

UniProt

P20333

Expression Region

27-203aa

Organism

Homo sapiens (Human)

Target Sequence

VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.

Molecular Weight

46.3 kDa

References & Citations

A second tumor necrosis factor receptor gene product can shed a naturally occurring tumor necrosis factor inhibitor.Kohno T., Brewer M.T., Baker S.L., Schwartz P.E., King M.W., Hale K.K., Squires C.H., Thompson R.C., Vannice J.L.Proc. Natl. Acad. Sci. U.S.A. 87:8331-8335 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit
MBS9342203-01 48 Well

Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit

Ask
View Details
Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit
MBS9342203-02 96 Well

Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit

Ask
View Details
Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit
MBS9342203-03 5x 96 Well

Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit

Ask
View Details
Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit
MBS9342203-04 10x 96 Well

Human Uncharacterized protein C3orf23, C3orf23 ELISA Kit

Ask
View Details
Rabbit Monoclonal SARS-CoV-2 Nucleocapsid Antibody (019) [Alexa Fluor 532]
NBP3-12735AF532 100 µL

Rabbit Monoclonal SARS-CoV-2 Nucleocapsid Antibody (019) [Alexa Fluor 532]

Ask
View Details
SCEL-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43142061 1.0 µg DNA

SCEL-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details