Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 25 (TMEM25)

Product Specifications

Product Name Alternative

0610039J01Rik; FLJ14399; Tmem25; TMM25_HUMAN; Transmembrane protein 25

Abbreviation

Recombinant Human TMEM25 protein

Gene Name

TMEM25

UniProt

Q86YD3

Expression Region

27-322aa

Organism

Homo sapiens (Human)

Target Sequence

ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.2 kDa

References & Citations

Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MTUS2 shRNA (UAS) - Lentiviral human MTUS2 shRNA (UAS) (100)
GTR15093114 1 Vial

Lentiviral human MTUS2 shRNA (UAS) - Lentiviral human MTUS2 shRNA (UAS) (100)

Sign In for Pricing
View Details
EphB1/2/3 discontinued
343184-01 100 µL

EphB1/2/3 discontinued

Sign In for Pricing
View Details
EphB1/2/3 discontinued
343184-02 200 µL

EphB1/2/3 discontinued

Sign In for Pricing
View Details
Integrin beta 5 (ITGB5) Human shRNA Plasmid Kit (Locus ID 3693)
TR312079 1 Kit

Integrin beta 5 (ITGB5) Human shRNA Plasmid Kit (Locus ID 3693)

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae UGA1 Protein (aa 1-471) [His]
VAng-Wyb6129-1mg 1 mg

Recombinant Saccharomyces Cerevisiae UGA1 Protein (aa 1-471) [His]

Sign In for Pricing
View Details
IL-1 alpha Mouse mAb
orb2716847-01 50 µL

IL-1 alpha Mouse mAb

Sign In for Pricing
View Details