Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transforming growth factor beta-1 proprotein (TGFB1), partial

Product Specifications

Product Name Alternative

TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP) ; Transforming growth factor beta-1; TGF-beta-1) ]

Abbreviation

Recombinant Chicken TGFB1 protein, partial

Gene Name

TGFB1

UniProt

P09531

Expression Region

278-391aa

Organism

Gallus gallus (Chicken)

Target Sequence

DLDTDYCFGPGTDEKNCCVRPLYIDFRKDLQWKWIHEPKGYMANFCMGPCPYIWSADTQYTKVLALYNQHNPGASAAPCCVPQTLDPLPIIYYVGRNVRVEQLSNMVVRACKCS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of th have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone rodeling. It is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodeling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus (By similarity) .

Molecular Weight

29 kDa

References & Citations

Complementary deoxyribonucleic acid cloning of a messenger ribonucleic acid encoding transforming growth factor beta 4 from chicken embryo chondrocytes.Jakowlew S.B., Dillard P.J., Sporn M.B., Roberts A.B.Mol. Endocrinol. 2:1186-1195 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OptiWell™ Deep Well Plates
D3096-07S 100 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
Apovincaminic Acid-d4
TRC-A729252-50MG 50 mg

Apovincaminic Acid-d4

Sign In for Pricing
View Details
Texas Red® goat anti-rabbit IgG (H+L)
16869-AAT 1 mg

Texas Red® goat anti-rabbit IgG (H+L)

Sign In for Pricing
View Details
Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852M1-01 20 Tests

Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852M1-02 100 Tests

Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852M1-03 2x 100 Tests

Elab Fluor® 700 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details