Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-1 proprotein (TGFB1), partial

Product Specifications

Product Name Alternative

TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP) ; Transforming growth factor beta-1; TGF-beta-1) ]

Abbreviation

Recombinant Bovine TGFB1 protein, partial

Gene Name

TGFB1

UniProt

P18341

Expression Region

279-390aa

Organism

Bos taurus (Bovine)

Target Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone rodeling as it is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity) . Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (By similarity) . Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus. Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (By similarity) .

Molecular Weight

16.8 kDa

References & Citations

Jiang C., Davis J.S.Complementary deoxyribonucleic acid cloning of bovine transforming growth factor-beta 1.van Obberghen-Schilling E., Kondaiah P., Ludwig R.L., Sporn M.B., Baker C.C.Mol. Endocrinol. 1:693-698 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD700 Anti-human CD3 Antibody *SK7*
100331A0-AAT 100 Tests

XFD700 Anti-human CD3 Antibody *SK7*

Sign In for Pricing
View Details
Tnrc6c Mouse Gene Knockout Kit (CRISPR)
KN518034 1 Kit

Tnrc6c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AIF (AIFM1) Mouse Monoclonal Antibody [Clone ID: 4E7]
AM06656SU-N 100 µL

AIF (AIFM1) Mouse Monoclonal Antibody [Clone ID: 4E7]

Sign In for Pricing
View Details
Mouse Agtrap activation kit by CRISPRa
GA200129 1 Kit

Mouse Agtrap activation kit by CRISPRa

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2295-01 50 μL

COLEC12 Antibody

Sign In for Pricing
View Details
COLEC12 Antibody
KC-2295-02 100 µL

COLEC12 Antibody

Sign In for Pricing
View Details