Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-1 proprotein (TGFB1), partial

Product Specifications

Product Name Alternative

TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP) ; Transforming growth factor beta-1; TGF-beta-1) ]

Abbreviation

Recombinant Bovine TGFB1 protein, partial

Gene Name

TGFB1

UniProt

P18341

Expression Region

279-390aa

Organism

Bos taurus (Bovine)

Target Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone rodeling as it is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity) . Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP) (By similarity) . Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells. Mediates SMAD2/3 activation by inducing its phosphorylation and subsequent translocation to the nucleus. Can induce epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types (By similarity) .

Molecular Weight

16.8 kDa

References & Citations

Jiang C., Davis J.S.Complementary deoxyribonucleic acid cloning of bovine transforming growth factor-beta 1.van Obberghen-Schilling E., Kondaiah P., Ludwig R.L., Sporn M.B., Baker C.C.Mol. Endocrinol. 1:693-698 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS808978 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Human Angiogenin Recombinant Rabbit monoclonal Antibody
HA725078H 100 µL

Human Angiogenin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UM1-01 25 µg

Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UM1-02 100 µg

Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Recombinant Human Carbonic Anhydrase 10/CA10 Protein
PKSH031484 20 µg

Recombinant Human Carbonic Anhydrase 10/CA10 Protein

Sign In for Pricing
View Details
Variable Volume Single Channel Micropipette BPIP-506
BPIP-506 1 Unit

Variable Volume Single Channel Micropipette BPIP-506

Sign In for Pricing
View Details