Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1A3 (SULT1A3)

Product Specifications

Product Name Alternative

Aryl sulfotransferase 1A3/1A4 Catecholamine-sulfating phenol sulfotransferase HAST3 M-PST Monoamine-sulfating phenol sulfotransferase Placental estrogen sulfotransferase Sulfotransferase 1A3/1A4 Sulfotransferase, monoamine-preferring Thermolabile phenol sulfotransferase Short name: TL-PST

Abbreviation

Recombinant Human SULT1A3 protein

Gene Name

SULT1A3

UniProt

P0DMM9

Expression Region

1-295aa

Organism

Homo sapiens (Human)

Target Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

Molecular Weight

50.2 kDa

References & Citations

"Human SULT1A3 pharmacogenetics: gene duplication and functional genomic studies."Hildebrandt M.A.T., Salavaggione O.E., Martin Y.N., Flynn H.C., Jalal S., Wieben E.D., Weinshilboum R.M.Biochem. Biophys. Res. Commun. 321:870-878 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK alpha Antibody (YA6076, Rabbit)
HY-P86384 1 Each

IKK alpha Antibody (YA6076, Rabbit)

Sign In for Pricing
View Details
APPL1 (Biotin)
555316-01 50 µg

APPL1 (Biotin)

Sign In for Pricing
View Details
APPL1 (Biotin)
555316-02 100 µg

APPL1 (Biotin)

Sign In for Pricing
View Details
Nα-Fmoc-Nγ-trityl-D-asparagine 4-alkoxybenzyl alcohol resin
sc-475462 1 g

Nα-Fmoc-Nγ-trityl-D-asparagine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Active Recombinant Human EIF2C2, His-tagged
EIF2C2-2180H 10 µg

Active Recombinant Human EIF2C2, His-tagged

Sign In for Pricing
View Details
SYNGR3 Peptide
MBS151842-01 0.05 mg

SYNGR3 Peptide

Sign In for Pricing
View Details