Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Saitohin (STH)

Product Specifications

Product Name Alternative

STH; Saitohin

Abbreviation

Recombinant Human STH protein

Gene Name

STH

UniProt

Q8IWL8

Expression Region

1-128aa

Organism

Homo sapiens (Human)

Target Sequence

MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.7 kDa

References & Citations

Strong association of the Saitohin gene Q7 variant with progressive supranuclear palsy.de Silva R., Hope A., Pittman A., Weale M.E., Morris H.R., Wood N.W., Lees A.J.Neurology 61:407-409 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCL Antibody
OC-229-01 50 μL

VCL Antibody

Sign In for Pricing
View Details
VCL Antibody
OC-229-02 100 µL

VCL Antibody

Sign In for Pricing
View Details
VCL Antibody
OC-229-03 1 mL

VCL Antibody

Sign In for Pricing
View Details
Cyclophilin F (PPIF) (Center) Rabbit Polyclonal Antibody
AP53411PU-N 400 µL

Cyclophilin F (PPIF) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anapc11 Mouse Gene Knockout Kit (CRISPR)
KN501220 1 Kit

Anapc11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP1B2 (Center) Rabbit Polyclonal Antibody
AP50294PU-N 400 µL

ATP1B2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details