Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Saitohin (STH)

Product Specifications

Product Name Alternative

STH; Saitohin

Abbreviation

Recombinant Human STH protein

Gene Name

STH

UniProt

Q8IWL8

Expression Region

1-128aa

Organism

Homo sapiens (Human)

Target Sequence

MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.7 kDa

References & Citations

Strong association of the Saitohin gene Q7 variant with progressive supranuclear palsy.de Silva R., Hope A., Pittman A., Weale M.E., Morris H.R., Wood N.W., Lees A.J.Neurology 61:407-409 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant AREB6 Monoclonal Antibody
AN301025L-01 50 µL

Recombinant AREB6 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant AREB6 Monoclonal Antibody
AN301025L-02 100 µL

Recombinant AREB6 Monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL
BNC400383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2,4-Benzenetricarboxylic Acid 2,4-Bis(2-ethylhexyl) Ester-d34
TRC-B190037-1MG 1 mg

1,2,4-Benzenetricarboxylic Acid 2,4-Bis(2-ethylhexyl) Ester-d34

Sign In for Pricing
View Details
DYR1A Antibody
8C11002-AAT 50 µg

DYR1A Antibody

Sign In for Pricing
View Details
CD63 Rabbit Monoclonal Antibody [Clone ID: R08-7C9]
TA421570 100 µL

CD63 Rabbit Monoclonal Antibody [Clone ID: R08-7C9]

Sign In for Pricing
View Details