Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukosialin (SPN), partial

Product Specifications

Product Name Alternative

Galactoglycoprotein ; GALGPLeukocyte sialoglycoprotein; Sialophorin; CD43

Abbreviation

Recombinant Human SPN protein, partial

Gene Name

SPN

UniProt

P16150

Expression Region

20-253aa

Organism

Homo sapiens (Human)

Target Sequence

STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

One of the major glycoproteins of thymocytes and T lymphocytes. Plays a role in the physicochical properties of the T-cell surface and in lectin binding. Presents carbohydrate ligands to selectins. Has an extended rodlike structure that could protrude above the glycocalyx of the cell and allow multiple glycan chains to be accessible for binding. Is a counter-receptor for SN/Siglec-1 . During T-cell activation is actively roved from the T-cell-APC (antigen-presenting cell) contact site thus suggesting a negative regulatory role in adaptive immune response .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

One of the major glycoproteins of thymocytes and T lymphocytes. Plays a role in the physicochemical properties of the T-cell surface and in lectin binding. Presents carbohydrate ligands to selectins. Has an extended rodlike structure that could protrude above the glycocalyx of the cell and allow multiple glycan chains to be accessible for binding. Is a counter-receptor for SN/Siglec-1 (By similarity) . During T-cell activation is actively removed from the T-cell-APC (antigen-presenting cell) contact site thus suggesting a negative regulatory role in adaptive immune response (By similarity) .

Molecular Weight

39.5 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipoamide Dehydrogenase Antibody
KC-32161-01 50 μL

Lipoamide Dehydrogenase Antibody

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Antibody
KC-32161-02 100 µL

Lipoamide Dehydrogenase Antibody

Sign In for Pricing
View Details
Lipoamide Dehydrogenase Antibody
KC-32161-03 1 mL

Lipoamide Dehydrogenase Antibody

Sign In for Pricing
View Details
(AlphaR,BetaS)-Bedaquiline
TRC-B119535-25MG 25 mg

(AlphaR,BetaS)-Bedaquiline

Sign In for Pricing
View Details
WFDC9 Human Gene Knockout Kit (CRISPR)
KN422677 1 Kit

WFDC9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANKS1A Human Gene Knockout Kit (CRISPR)
KN422439 1 Kit

ANKS1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details