Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Superoxide dismutase [Cu-Zn] (Sod1)

Product Specifications

Product Name Alternative

Sod1; Superoxide dismutase [Cu-Zn]; EC 1.15.1.1

Abbreviation

Recombinant Mouse Sod1 protein

Gene Name

Sod1

UniProt

P08228

Expression Region

2-154aa

Organism

Mus musculus (Mouse)

Target Sequence

AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Destroys radicals which are normally produced within the cells and which are toxic to biological systs.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Molecular Weight

19.8 kDa

References & Citations

Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.Rardin M.J., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J., Li B., Schilling B., Mooney S.D., Kahn C.R., Verdin E., Gibson B.W.Proc. Natl. Acad. Sci. U.S.A. 110:6601-6606 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cadherin 24 (CDH24) ELISA kit
GTR10447806 96 Well

Human Cadherin 24 (CDH24) ELISA kit

Sign In for Pricing
View Details
TMEM43 polyclonal antibody
orb647315-01 50 μL

TMEM43 polyclonal antibody

Sign In for Pricing
View Details
TMEM43 polyclonal antibody
orb647315-02 100 µL

TMEM43 polyclonal antibody

Sign In for Pricing
View Details
TMEM43 polyclonal antibody
orb647315-03 200 µL

TMEM43 polyclonal antibody

Sign In for Pricing
View Details
Mouse Monoclonal FAF1 Antibody (CPTC-FAF1-2) [DyLight 755]
NBP3-08227IR 100 µL

Mouse Monoclonal FAF1 Antibody (CPTC-FAF1-2) [DyLight 755]

Sign In for Pricing
View Details
Anti-HYAL1 Antibody Picoband® Fluoro550 Conjugated
A04099-1-Fluoro550 100 µg/Vial

Anti-HYAL1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details