Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-24 (SNX24)

Product Specifications

Product Name Alternative

PRO1284; SBBI31; SNX24; SNX24_HUMAN; Sorting nexin 24; Sorting nexin-24; Sorting nexing 24; UNQ654

Abbreviation

Recombinant Human SNX24 protein

Gene Name

SNX24

UniProt

Q9Y343

Expression Region

1-169aa

Organism

Homo sapiens (Human)

Target Sequence

MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

May be involved in several stages of intracellular trafficking.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in several stages of intracellular trafficking.

Molecular Weight

35.8 kDa

References & Citations

N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UEVLD activation kit by CRISPRa
GA110680 1 Kit

Human UEVLD activation kit by CRISPRa

Sign In for Pricing
View Details
Cog1 Mouse Gene Knockout Kit (CRISPR)
KN503604 1 Kit

Cog1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MTMR8 activation kit by CRISPRa
GA110823 1 Kit

Human MTMR8 activation kit by CRISPRa

Sign In for Pricing
View Details
Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody
TA361451 100 µL

Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse VCAM-1 protein (His tag)
PDMM100192-01 20 µg

Recombinant Mouse VCAM-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse VCAM-1 protein (His tag)
PDMM100192-02 100 µg

Recombinant Mouse VCAM-1 protein (His tag)

Sign In for Pricing
View Details