Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-synuclein (Snca)

Product Specifications

Product Name Alternative

Snca; Alpha-synuclein

Abbreviation

Recombinant Rat Snca protein

Gene Name

Snca

UniProt

P37377

Expression Region

1-140aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

May be involved in the regulation of dopamine release and transport.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of dopamine release and transport.

Molecular Weight

41.5 kDa

References & Citations

The UCH-L1 gene encodes two opposing enzymatic activities that affect alpha-synuclein degradation and Parkinson's disease susceptibility.Liu Y., Fallon L., Lashuel H.A., Liu Z., Lansbury P.T. Jr.Cell 111:209-218 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 2 CAPN2 Mouse Monoclonal Antibody (Fluoro647)
orb3084541 100 µg

Calpain 2 CAPN2 Mouse Monoclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Direct-zol™ RNA MiniPrep (200 Preps) w/ Zymo-Spin™ IIC Columns (Capped)
R2052 200 Preparations

Direct-zol™ RNA MiniPrep (200 Preps) w/ Zymo-Spin™ IIC Columns (Capped)

Sign In for Pricing
View Details
RPL23A Antibody Blocking peptide
orb1451624 500 µg

RPL23A Antibody Blocking peptide

Sign In for Pricing
View Details
ZNF14 Rabbit Polyclonal Antibody (HRP)
orb2111792 100 µL

ZNF14 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Major cold shock protein CspA (cspA)
MBS1199916-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Major cold shock protein CspA (cspA)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Major cold shock protein CspA (cspA)
MBS1199916-02 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Major cold shock protein CspA (cspA)

Sign In for Pricing
View Details