Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sperm mitochondrial-associated cysteine-rich protein (SMCP)

Product Specifications

Product Name Alternative

HSMCSGEN1 ; MCS ; MCSP ; MCSP_HUMAN; Mitochondrial capsule selenoprotein; SMCP; Sperm mitochondria associated cysteine rich protein; Sperm mitochondrial-associated cysteine-rich protein

Abbreviation

Recombinant Human SMCP protein

Gene Name

SMCP

UniProt

P49901

Expression Region

1-116aa

Organism

Homo sapiens (Human)

Target Sequence

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the fale reproductive tract and inability to penetrate the oocyte zona pellucida .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity) .

Molecular Weight

39.8 kDa

References & Citations

Isolation, expression, and chromosomal localization of the human mitochondrial capsule selenoprotein gene (MCSP) .Aho H., Schwemmer M., Tessmann D., Murphy D., Mattei M.-G., Engel W., Adham I.M.Genomics 32:184-190 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC35E4 activation kit by CRISPRa
GA117436 1 Kit

Human SLC35E4 activation kit by CRISPRa

Sign In for Pricing
View Details
Lentiviral human PNMA6F sgRNA gene knockout kit - Lentiviral human PNMA6F sgRNA gene knockout kit (plasmid)
GTR15389240 1 Vial

Lentiviral human PNMA6F sgRNA gene knockout kit - Lentiviral human PNMA6F sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HOPX, CT (HOPX, HOD, HOP, LAGY, NECC1, OB1, Homeodomain-only protein, Lung cancer-associated Y protein, Not expressed in choriocarcinoma protein 1, Odd homeobox protein 1) (MaxLight 650) discontinued
036677-ML650 100 µL

HOPX, CT (HOPX, HOD, HOP, LAGY, NECC1, OB1, Homeodomain-only protein, Lung cancer-associated Y protein, Not expressed in choriocarcinoma protein 1, Odd homeobox protein 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
C10orf91
556742-01 50 µg

C10orf91

Sign In for Pricing
View Details
C10orf91
556742-02 100 µg

C10orf91

Sign In for Pricing
View Details
ANKRD20A8P (Ankyrin Repeat Domain-Containing Protein 20B, Ankyrin Repeat Domain-Containing Protein 20A Pseudogene, ANKRD20A8P, ANKRD20B) (MaxLight 490) discontinued
302265-ML490 100 µL

ANKRD20A8P (Ankyrin Repeat Domain-Containing Protein 20B, Ankyrin Repeat Domain-Containing Protein 20A Pseudogene, ANKRD20A8P, ANKRD20B) (MaxLight 490) discontinued

Sign In for Pricing
View Details