Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein sigma (SFN)

Product Specifications

Product Name Alternative

Epithelial cell marker protein 1Stratifin

Abbreviation

Recombinant Human SFN protein

Gene Name

SFN

UniProt

P31947

Expression Region

1-248aa

Organism

Homo sapiens (Human)

Target Sequence

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.

Molecular Weight

54.8 kDa

References & Citations

Identification and structural characterization of two 14-3-3 binding sites in the human peptidylarginine deiminase type VI.Rose R., Rose M., Ottmann C.J. Struct. Biol. 180:65-72 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nudt19 sgRNA CRISPR Lentivector set (Rat)
K7468801 3x 1.0 µg

Nudt19 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral human PMP2 shRNA (UAS) - Lentiviral human PMP2 shRNA (UAS, RFP) plasmid
GTR15131137 1 Vial

Lentiviral human PMP2 shRNA (UAS) - Lentiviral human PMP2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Altenuene-d3
HY-N6713AS 1 Each

Altenuene-d3

Sign In for Pricing
View Details
Rel- (3R,4R) -3-Hydroxy-4-methoxypyrrolidine-1-carboxylic acid tert-butyl ester
OR1038791-01 100 mg

Rel- (3R,4R) -3-Hydroxy-4-methoxypyrrolidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
Rel- (3R,4R) -3-Hydroxy-4-methoxypyrrolidine-1-carboxylic acid tert-butyl ester
OR1038791-02 250 mg

Rel- (3R,4R) -3-Hydroxy-4-methoxypyrrolidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
Rel- (3R,4R) -3-Hydroxy-4-methoxypyrrolidine-1-carboxylic acid tert-butyl ester
OR1038791-03 1 g

Rel- (3R,4R) -3-Hydroxy-4-methoxypyrrolidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details